SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020253 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020253
Domain Number 1 Region: 28-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.0033
Further Details:      
 
Domain Number 2 Region: 98-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000251
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number 3 Region: 188-233
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000667
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020253   Gene: ENSMODG00000016205   Transcript: ENSMODT00000020610
Sequence length 235
Comment pep:known_by_projection chromosome:BROADO5:1:500479013:500497290:1 gene:ENSMODG00000016205 transcript:ENSMODT00000020610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTPQERPLLALSLLCLLFEVCAQLCRMPCTCPRIPPRCPPGAPLVLDGCGCCRVCARRL
GEPCDQLNICDQSQGLVCNYSASLGNRRGTCNFPEDDGSCEVNGRTYRDGETFQPSCKFQ
CHCSDGGFTCIPLCSEDVRLPSWDCPYPQRVDVPGKCCQEWVCDQGFQPLPATVPRFLGP
PVPLSTQFVCQEWSTLWGPCSATCGLGVATRVSNQNPHCRLEIQHRLCLLRACPP
Download sequence
Identical sequences F7FY31
XP_001379504.1.35504 ENSMODP00000020253 ENSMODP00000020253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]