SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020402 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020402
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily RING/U-box 1.59e-19
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 2 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.51e-16
Family B-box zinc-binding domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020402   Gene: ENSMODG00000016323   Transcript: ENSMODT00000020760
Sequence length 390
Comment pep:novel chromosome:BROADO5:Un:92465284:92466453:-1 gene:ENSMODG00000016323 transcript:ENSMODT00000020760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKFEEELTCPICYSIFEDPRVLPCSHTFCRKCLENVLQASGNFYGRRDITCPTCRHIIE
ITPPGIDSLPINFALRAIIEKYEQEEHPDGITCPEHSSQPLNMYCLQDRQPVCGHCLTIG
QHQGHPIEDLQSAYKKEKEEPLKLFKQLTEGPLGDVSLLLEKLEEQKSHVEQIIQSDKET
VLQYFKELNGILDLKKNALLSSLDDARREIDKEYTPQIDRMKEIREEYIKLQSCTAFLGD
EESPLKFLKKIHSVHQGVQALRQRKLPSVQPLEICPRIGPILKEEWARTEIGQIKNLVTK
IKLSPQRMEKKGQFEKIFCIFMRIILQVYISTGLFLFNFNNLPVLPNEGSGYLSEDSQSP
DHSFFNIIIKESVCPADHKLKRFPWDNDSL
Download sequence
Identical sequences H9H6T5
13616.ENSMODP00000020402 ENSMODP00000020402 ENSMODP00000020402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]