SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020407 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020407
Domain Number 1 Region: 1380-1443,1477-1660
Classification Level Classification E-value
Superfamily VPS9 domain 1.96e-40
Family VPS9 domain 0.002
Further Details:      
 
Domain Number 2 Region: 13-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.76e-39
Family Regulator of chromosome condensation RCC1 0.0066
Further Details:      
 
Domain Number 3 Region: 530-688
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.71e-28
Family Regulator of chromosome condensation RCC1 0.039
Further Details:      
 
Domain Number 4 Region: 1048-1137
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.59e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 
Domain Number 5 Region: 1142-1251
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 6.41e-20
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.026
Further Details:      
 
Domain Number 6 Region: 913-1008
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000446
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 7 Region: 693-892
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000144
Family DBL homology domain (DH-domain) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020407   Gene: ENSMODG00000016329   Transcript: ENSMODT00000020766
Sequence length 1801
Comment pep:known_by_projection chromosome:BROADO5:7:194779976:194876640:1 gene:ENSMODG00000016329 transcript:ENSMODT00000020766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPERSSAEAEGAKERGLVHVWQAGFCSITPERLPGWGGKTVLQAALGVSHGVLLTEGG
EVYSFGNLPWRSEPEEICPKSPLLENALVGQHVITVATGSFHSGAVTENGMVYMWGQNSA
GQCAIANQHHVPEPTPVSISDSETSPLLSVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTTFPVTKPQKVEHLAGRVVLQVACGDSHSLALVQCLPSQDVKPVPERCNHCSQLLI
TMTDKEDHVIISDSHCCPLGVALSETQAESHDAITPSTGESLESKNLSKSQGGEKKTLRE
NGLSVASEVNIENMQPVNAEATHPEQEITEATGIPILGNVPLFPDNHVEKACLQKLSDDS
LQGHPETGGEVEVAQSLTEEPNPSLPSPPTTSTSALNSLVVSCASAVGVRVAATYEAGAL
SLKKVMNFYSIAPCESGLQSGNASLGPEGLKDSREEQVKLESMQGKKSSSLVDIREEESE
GVSRRLSLPGLLSQVSPRLLRKAARAKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKE
GQLGHGDVLPRLQPLCVKCLDGKEVIQLAAGGHHSLALTAKSQVYSWGSNTFGQLGHSDS
PTTIPRLAKVCDENGIWSIAAGQDYSLFLADTDDFQPGLYYSGRQEPAESDHDICTKTAS
LLGSCSKLGYISSVTAGKNSCLALVDKNIMGYIASLHELATTERRFYSKLSDIKSQILRP
LLGLENLGTTTTVQLLQDVASRFSKLCYLIGQHGASLSSFLHGIKEAKSLAILKHASLFL
DSYTEYCTSITNFVVMGGFQLLAKPATDFLNKNQELLQDLSEVNEENIQLVELLNTLFFL
PIRRLHNYARVLLKLATCFEVTSPEYHKLQDSSSCYETLALHLGRKRKEAEYTLGFWKTF
PGKMTDSLRKPERRLICESSNRALSLQHAGRFSVNWFILFNDSLVHAQFSTHHIFPLSTL
WVEPISEEVGSVNGLKITTPEEQFILVSSTPQEKTKWLRAISQAVDQALRGMSDFPPYGS
GSSVPRQEPPISRSARYTFYKDPRLKDAIYDGRWLSGKPHGRGTLKWTDGKMYSGMFRNG
LEDGYGEYKVPNKALNKDDHYVGYWKEGKMCGQGVYSYANGEVYEGCFQDNMRHGHGLLR
SGKLTSSSPSMFIGQWVMDKKSGYGVFDDITRGEKYMGMWQDDMCQGNGVVVTQFGLYYE
GTFSLNKMMGTGILLSEDDTVYEGEFSDDWTLNGKGTLTMPNGDYIEGLFNGEWGSGIKI
TGTYFKPSLYESEKDRPKILRKLGNLAVPADEKWKAVFEECWHQLGCENPGQGELWKAWD
NIAVALTTNRRQHRDSPEILSRSHTQTLESLEFIPQHVGGAFTVEKYDEIKKYLIKACDT
PLHPLCRLIETLVAVYRMTYVGVGANRRLLQEAVKEIQSYLKRIFQLVRFLFPDLPEEGS
TIPLSVPLPQERKSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALEND
REEDIYWECVLRLNKQPDTALLSFLGVQRKFWPVTLSVFGDTKKVLPTTKDSCFASAVEC
LQQISTTFTPSDKLKVIHQTFEEISQSVLATLQEDFLWSMDDLFPVFLYVVLRARIRNLG
SEVHLIEDLMDPYLQHGEQGIMFTTLKACYFQFQGEKLNKTPPPRNPNGVGIRDCIGSSP
FPGGAKKNPPPPPKATEDLVLLHASSTDGAAPELLKGPRRRSREEASWGSTERCHWFPGC
TCPIQDHLLRAHVWPQRWGREPQTRRGASGASWEVCEYSELLVISVLLALTGSLLKNQIV
P
Download sequence
Identical sequences F7FL33
ENSMODP00000020407 ENSMODP00000020407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]