SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020434 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020434
Domain Number 1 Region: 1810-1891
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000343
Family Canonical RBD 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020434
Domain Number - Region: 1201-1266
Classification Level Classification E-value
Superfamily UBA-like 0.0199
Family UBA domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020434   Gene: ENSMODG00000016348   Transcript: ENSMODT00000020794
Sequence length 1998
Comment pep:known_by_projection chromosome:BROADO5:6:145136768:145440912:1 gene:ENSMODG00000016348 transcript:ENSMODT00000020794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQVKDEFYSFKCQEEVFSCSELEDIERELEAKATKEVERKLSRDFFVMPGRDLVKEEEE
QLMEERKKRKDDKKKKEAAQKKATEQKIKVPEQIKPSVSQPQPANSTNGTSTATSTQNNA
KRATASTQQQQQQALPRYPRGEVPPRFRHQEHKQLLKRGQQLPTIAANLGPATKVLNTQS
RGSSITSKQPVTNGERQNKKKQPGMPPIRDLVSHSPNQSDLNHSNLGSHYENSHWGPVSS
NSDSSTNWDKVIIEGSDKEAWPSITDSDPELTSECMDTDSASSSGSEKNLLIMASGSTSG
ENDGIRNGIGHSSQNKFVVGSNSNNVGNGSNNGPWSLSHGTIISTCQVSVDAPDSKSESS
NNRMNAWGTVSSSSNGGLNPSTLNSNSNHGAWPVLENNGHALKGPVGSGNSGTNIQCSTI
GQMPNNQSINSKMGGSTHDSWGSLQENCESEVNGTRKVSFSGQPQNLNTEMNGPNNTTNF
MTSSLPNAVGSVQMDELPNNTGHGAWRVSTRNHSQIQASSVTNGTSISHLSNGESKNSGS
YGTTWSAYGSNYSGEKCSGPNDQANGDTVNATLMQSGINGSVGTNFQMNGNKGGSLWESE
MVNSQNVPWGSGNGVNSGGNRRGWGSPAQNTGTNVSNGEWNKLPSNQHSNESINGNSRKF
TNGWKPTEEDDQSSAPSQTNEQNTIWAKTTGTGESEGSTESTGCREERVVGEGQSRERRK
VDQHALLQSIVNRSDLDPRVLSNKGWGETPIKQNTAWDTETSPRGERKTDNGTEAWGRSL
TQTSNSGGCVDKTNSNDTSSVSGWGDPKPATRWGDSKGSSSQGGWEDDSAATVMVKSNQL
WGNGKEEKSTWNDAQKIKQGWGDGQKSNQGWSVSANDNWGETSRSNHWGETKKSSSGGSD
SDRSVSGWNEPGKSNSFTWGNNNMNPNNSSSWDEPSKSSQTQGWGEPPKSNQPSGWGDSS
KPINSPDWNKQDIGGSWGAPPSTNKPPGTGWLGGPIPASTKEEEPTGWEEPSPESIRRKM
EIDDGTSAWGDPSKYNYKNVNMWNKNVPNGGSRSDQQAQVHQPLPSSSAMSNKESGSCSG
WGEPWGEPSTPATTVDNGTSAWGKPMDTGTNWGEPITASSSSSTWGTTSVGPQTSSKPGP
KSMQDGWCGDDMPLTGNRPTAWEEEEDVEIGMWNSNSSQEVNPSLNWPPYIKKMSSKGTM
KGGNKQDETWINPFVKQFSNLSFSRESPEETLQSNKMDLSGGMLQDKRMEIDKHSLNIGD
YNRVVGKGPGSRPQISKESSMDRSPYFDKDGIVADESQNMQFMSNQNMKLPPSNSALPNQ
ALGSIAGLGMQNLNSVRQNGNPSMFGVGNTAAQPRGMQQPPAQPLSSSQPHLRAQVPPPL
LSPQVPVSLLKYAPNNGGLSPLFGPQQVAMLSQLSQLNQLSQISQLQRLLTQQQKVQNQR
SMPSGGRQQQEQQGRPLSMQQQMMQQSRQLDPNLLMKQQTPPSQPQSLHQPAMKSFLENV
MPHTTPELQKGPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWTTVDSISVNTSL
DQNSSKHGAISSGFRLEESPFVPYEFMNSSNSPASPPGSIGDGWPRAKSPNGSSSVNWPP
EFRPGEPWKGYPNIDPETDPYVTPGSVINNLSINTVREVDHLRDRNSGSSSSLNTTLPST
SAWSSIRASNYNVSLSSTAQSTSARNSDSKSTWSPGSVTNTSLAHELWKVPLPPKNITAP
SRPPPGLTGQKAPLSTWDNSPLRIGGGWGNSDARYTPDPAHYPSATPAQDTHIDGLIRWA
AGPGSSWGESSSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNALVRYS
SKEEVVKAQKSLHMCVLGNTTILAEFASEEEISRFFAQGQSLTPSPGWQPLGSSQSRLGS
IDSSHSFSNRNDLNHWNGAGLSGTSSGDLHGTSLWGTPNYSTSLWGTPNSSDTRGISSPS
PINAFLSVDHLGGGGESM
Download sequence
Identical sequences F7F790
ENSMODP00000020434 ENSMODP00000020434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]