SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020528 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020528
Domain Number 1 Region: 92-394
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000655
Further Details:      
 
Domain Number 2 Region: 2-98
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-21
Family SH2 domain 0.0000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020528   Gene: ENSMODG00000016433   Transcript: ENSMODT00000020892
Sequence length 418
Comment pep:novel chromosome:BROADO5:4:388834946:388846218:1 gene:ENSMODG00000016433 transcript:ENSMODT00000020892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGSFLVRESQSKPGDFVLSVLTQELDKLDGGDRRPRVTHVMIRFQADGKYDVGGGERFD
TLTDLVEHYKKNPMVEKSGAVVHLKQPFNATRINAANIENRVKELNKMADQSEKAKQGFW
EEFEMLQQQECKLLYPRKEGQRPENKAKNRYKNILPFDTTRVTLREVDGSVPGADYINAN
YIKVRVATYPTSQEPSKVYIATQGCLQTTVNDFWAMVYQENTHVIVMTTKEMERGRNKCF
RYWPDQHCTKDYGCVRVQHVSEREAQGYYVRELEMGRTDREEQPRKVTHYQYFSWPDHGV
PTEPGGVLSFLDQVNQAQSSVPGSGPIVVHCSAGIGRTGTIIVIDILVDTIRRQGLDCDI
DIPRTIQRVRQQRSGMVQTEAQYKFVYMAVQRHIEGEQWRLQEEQRNKQKEREYLNIR
Download sequence
Identical sequences F7ASC3
13616.ENSMODP00000020528 ENSMODP00000020528 ENSMODP00000020528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]