SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020553 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020553
Domain Number 1 Region: 8-113
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-27
Family Canonical RBD 0.00000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020553   Gene: ENSMODG00000016458   Transcript: ENSMODT00000020918
Sequence length 234
Comment pep:known_by_projection chromosome:BROADO5:1:486450289:486486040:-1 gene:ENSMODG00000016458 transcript:ENSMODT00000020918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLQQAPCSLSGGRPPAGTMHTLQKDTTFTKIFVGGLPYHTTDSSLRKYFEGFGDIEEAV
VITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSIHTGFTI
GVQQLHPAFIQRSYGLTPHYIYPQAIVQPSVVIPAPVQSIASPYIDYTAANQAYTQYTTA
AYDQYPYASSPAAGFVGYGYTSAVQAPLATTNPAAATTAFVQYQPPQLQPDRMQ
Download sequence
Identical sequences F7A3F9
XP_001368885.1.35504 ENSMODP00000020553 ENSMODP00000020553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]