SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020576 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020576
Domain Number 1 Region: 27-130
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.9e-25
Family Canonical RBD 0.01
Further Details:      
 
Domain Number 2 Region: 223-327
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-22
Family Canonical RBD 0.0000385
Further Details:      
 
Domain Number 3 Region: 136-223
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.64e-18
Family Canonical RBD 0.0000126
Further Details:      
 
Domain Number 4 Region: 443-515
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000176
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020576   Gene: ENSMODG00000016478   Transcript: ENSMODT00000020941
Sequence length 538
Comment pep:known_by_projection chromosome:BROADO5:1:40396758:40493384:-1 gene:ENSMODG00000016478 transcript:ENSMODT00000020941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESNQKSGDGLSGTQKEAALRALIQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFI
GKLPRDLFEDELVPLCEKIGKIYEVRMMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYE
IRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRG
FAFVEYESHRAAAMGRRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLML
STSEETLEKEFNSIKPGSVERVKKIRDYAFVHFNNRDDAVNAMKALNGKVLDGSPIEVTL
AKPVDKDSYVRYTRGTGGRGSGLQGEYTYPLGHVYDPATAYLGAPVFYAPQAYAAIPNLH
FPVAKGPLSNRAILRPPSIRGAAGVRGLGGRGYLAYLGRGRGYQVKGDKRGEDKLYDILP
GMELTPMNQVTLKPQGMKLAPQVLEEICQKNNWGQPVYQLHSALGQDQRQLFLYKISIPA
LANQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPVEGTEALPTAAAAAAAFPGA
Download sequence
Identical sequences F6ZDI9
ENSMODP00000020576 ENSMODP00000020576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]