SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020775 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020775
Domain Number 1 Region: 309-392
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000149
Family Splicing factor U2AF subunits 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020775   Gene: ENSMODG00000016648   Transcript: ENSMODT00000021142
Sequence length 401
Comment pep:known_by_projection chromosome:BROADO5:8:127235041:127281687:1 gene:ENSMODG00000016648 transcript:ENSMODT00000021142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRG
SSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQ
RQRELERQKEIEEREKRRKDRHEASGFSRRPDPDSDEDEDYERERRKRSMGGAAIAPPTS
LVEKDKELPREFPFEEESRPRSQSSKAAIPPPVYDEQERPRSPTGPSNSFLANMGGTVAH
KIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKDASKKSDSNPLTEIL
KCPTKVVLLRNMVGAGEVDEDLEGETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFE
RVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV
Download sequence
Identical sequences F7GGT5 G3WGR4
XP_001362735.1.35504 XP_003771449.1.9362 ENSMODP00000020775 ENSMODP00000020775 ENSSHAP00000014619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]