SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020843 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020843
Domain Number 1 Region: 71-222
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 2.75e-43
Family Obg GTP-binding protein N-terminal domain 0.0000223
Further Details:      
 
Domain Number 2 Region: 216-337
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-34
Family G proteins 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020843   Gene: ENSMODG00000016699   Transcript: ENSMODT00000021210
Sequence length 362
Comment pep:known_by_projection chromosome:BROADO5:1:478011884:478025438:-1 gene:ENSMODG00000016699 transcript:ENSMODT00000021210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSRLVSTLTRAILEGRWPWIPAASTLLDPGYLFQQQVSPRPLFLSCAKCANHQKPKQK
RNLSEKKLKRYFVDRRRVFVTGGNGGNGISCFHSEPRKEFGGPDGGDGGDGGHVILKVDK
HIRSLSSVLSVYHGFDGEPGGNKNCFGRNGDCLYIRVPPGTLVKEENEIVADLAQPGDEY
IAALGGAGGKGNRFFLANDNRAPMTCTPGQQGQERVLHLELKTMAHAGMVGFPNAGKSSL
LRVISNAKPAVASYPFTTLNPHVGIVHYEGYQQVAVADIPGLIKGAHQNRGLGFAFLRHI
ERCRFLLFVVDLSVAEPWTQLEDLKYELEKYEEGSIRTKGHPLVSIDWREPRGIAVTFER
NV
Download sequence
Identical sequences F7D2H5
ENSMODP00000020843 ENSMODP00000020843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]