SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020923 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020923
Domain Number 1 Region: 20-111,315-399
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.85e-45
Family Canonical RBD 0.00000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020923   Gene: ENSMODG00000016763   Transcript: ENSMODT00000021292
Sequence length 403
Comment pep:known_by_projection chromosome:BROADO5:8:134881589:135023170:1 gene:ENSMODG00000016763 transcript:ENSMODT00000021292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLS
RGCAFVTFSTRAMAQNAIKTMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQ
LNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAA
AAQTSATTTNANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGL
NNINALAVAQMLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQS
LLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKC
FGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
Download sequence
Identical sequences F7GGL3
ENSMODP00000020923 ENSMODP00000020923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]