SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020938 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020938
Domain Number 1 Region: 68-169
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-26
Family SH2 domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020938   Gene: ENSMODG00000016772   Transcript: ENSMODT00000021307
Sequence length 365
Comment pep:known_by_projection chromosome:BROADO5:2:191895789:191907324:-1 gene:ENSMODG00000016772 transcript:ENSMODT00000021307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPNLSLASKDEGVPSNHTKVSLQGQGAMPTPDHTSKAEEVPGLGGPSLQAETRAWFQR
TQAPWFLDHGEAPVWFHGFITRREAEGLLENKPPGCYLVRFSESAVAFVLTYRSCSCYRH
FLLAQLQDGRHVVLGENSAHERLPDLLRHYTLHPLSPYGEHLTQPCVRQTPAPAGISMQI
EHSESRTEDRNGAAQYSPGHKQEQALGPVSKNNSEPKEPEEVLELPKPKPPVPAKPQIRP
ELYSIPAPKAQRSAPHPVPSHPIYQEPEEPIAFYAMGRGNKRDGLANVYSEVAPLPLQHH
FLHKCQSRPIRVSQTLDPASLIVGQGPTPSLQLPPSQGHTFPRNFSWQIPQDRGQVQLLL
GPNKH
Download sequence
Identical sequences F7GGB2
ENSMODP00000020938 ENSMODP00000020938 XP_007482162.1.35504 XP_016285921.1.35504 XP_016285922.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]