SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020940 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020940
Domain Number 1 Region: 239-297
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.19e-17
Family Erythroid transcription factor GATA-1 0.00056
Further Details:      
 
Domain Number 2 Region: 187-237
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.65e-16
Family Erythroid transcription factor GATA-1 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020940   Gene: ENSMODG00000016774   Transcript: ENSMODT00000021310
Sequence length 397
Comment pep:known_by_projection chromosome:BROADO5:1:477084949:477115236:1 gene:ENSMODG00000016774 transcript:ENSMODT00000021310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQSLALASNPGQAPYTHDSSSFLHSPAASSPVYVPTTRVPSMLPTMPYLAGCEAAHQSH
PLGSHPSWAQASGEASAFNPGSPHPPSGFSYSHSPPGGSGGGRDGTYQSPLLLGSGTREQ
YTNPLVRSVSGSYSNAYPAYVSPDMPPSWTTGHFESSVLHSLQSRQAGLPGRRSTFVSEF
LEEFPGEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQKRLSSTRR
AGLCCTNCHTTNTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKNIA
KAKSSTGSNASATNSPSSITNSDSTATLKSEPTLTSPQYPGQTIVSQGPSPAEDPLGPSH
SEFKFEPEDYAFPSSVTSQSGLSVPLRQDSWCALALA
Download sequence
Identical sequences F7GG55
ENSMODP00000020940 XP_001368185.1.35504 ENSMODP00000020940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]