SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020966 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020966
Domain Number 1 Region: 150-311
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.23e-32
Family DnaQ-like 3'-5' exonuclease 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020966   Gene: ENSMODG00000016797   Transcript: ENSMODT00000021336
Sequence length 324
Comment pep:known_by_projection chromosome:BROADO5:2:191774351:191779849:-1 gene:ENSMODG00000016797 transcript:ENSMODT00000021336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLILNLDFGDCPPPKKATEGNHRHQRFIQRQRRLQRNLKQKQTQVSAKTSGLGHPKPQ
NKGVTLSTSSKQKLHPLPEPIREKPNQKNGIDRPEQESINSVLVTPAPSRKTSSLSVVSK
VDLLSEFQSGLCSLPPARTLPAGTEKGKKMVALDCEMVGTGPKGHTSSLARCSIVSYSGD
ILYDEYIRPPCKIVDYRTKWSGIKKEHMINATPFKVARREILKILLGKIVVGHAIHNDFK
ALHYFHPKPLTRDTSRIPILNSRAGFPENESISLKRLTKQLLQQDIQVGKSGHSSVEDAK
ATMDLYKLVEVEWEQQLARSPPSQ
Download sequence
Identical sequences F7FVU8
13616.ENSMODP00000020966 ENSMODP00000020966 ENSMODP00000020966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]