SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020968 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020968
Domain Number 1 Region: 14-282,313-405
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000144
Family Hermes transposase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020968   Gene: ENSMODG00000016800   Transcript: ENSMODT00000021338
Sequence length 411
Comment pep:novel chromosome:BROADO5:1:475926081:475927333:-1 gene:ENSMODG00000016800 transcript:ENSMODT00000021338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLHQHLQNSTRKLSYFSLVLNESNDVHDSAQLLIFIYEMIDNFKVTEELAALQSIKGTTT
GEDIYEKVSQTVKDLELDWAKLANVTTDSAPSMMGSKKGVIAHINQEMGKCNHFHPIAIH
CLIHQQALLCSKSLKWDSVMKIVVSCVNFIRANALNHRQFQEFLSELNVAYENVLYHTEV
HWLSQGRVLRHFYVSQIMDFIFSKNKEVPEFHDAEGTWHLAFLTDVTELLNNFNVQLQGK
GKLICDMQSHVKAFEVKLGLLIKQMKEENFCHLPLTQNLLAEKPLIAFPKETCVDSLEKL
QKKAFPYSFSITHFLLTLKMWIQFTKWNWLNCRIVTLKDAFKSSNWINFYASLPCETYPN
LRNHALKMATIFGSTYVCEQTFYRMKHLQCPTRSRLTDALLHHLLQLAAKS
Download sequence
Identical sequences F7FVT7
ENSMODP00000020968 ENSMODP00000020968 13616.ENSMODP00000020968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]