SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020979 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000020979
Domain Number - Region: 304-364
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000718
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020979   Gene: ENSMODG00000016809   Transcript: ENSMODT00000021349
Sequence length 423
Comment pep:known_by_projection chromosome:BROADO5:1:739767570:739778150:-1 gene:ENSMODG00000016809 transcript:ENSMODT00000021349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLALLSLDGVVLSPTENDFVHHVKEELDRFLLEKQLSRAQTTSLPLSTLAEDIPHFTLPA
AQWECFLPSPVWGKGWWGRVLAITSLCSQGLPNLDNFTPSCPVPGRHGKPRRPRPSFPQE
PAPASRGPRPNRRQRGRKPDQALYVPRALRRKAERGADPAPPGPEPGDKDEDPTGEIPQE
AEDNGSGDQCPGSNSTLPSQAESGLEGGVKDQNQTAQGKPEPDSDSSQPEKGDCQESDSR
LPRALEGGSEPPPAKNPEEEEESGCSEDEPAELIQEIMDNLVDREIQIEKIHLDSSYLED
EHTTGENGFGHVVEIYGFEPSLKTEDIMEVFSEFQEKGFKIQWVDDTHALGVFPCLSSAT
EALSRDFPMLKIRPLTQGTKQSKLKALQRPKLLRLAKERPQTNTAVARRLVARALGLQNK
CRE
Download sequence
Identical sequences F7FVH0
ENSMODP00000020979 ENSMODP00000020979 13616.ENSMODP00000020979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]