SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020983 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020983
Domain Number 1 Region: 703-870,919-1065
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-82
Family Protein kinases, catalytic subunit 0.00000268
Further Details:      
 
Domain Number 2 Region: 116-156
Classification Level Classification E-value
Superfamily UBA-like 5.71e-17
Family UBA domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020983   Gene: ENSMODG00000016812   Transcript: ENSMODT00000021353
Sequence length 1151
Comment pep:known_by_projection chromosome:BROADO5:2:429352735:429388134:-1 gene:ENSMODG00000016812 transcript:ENSMODT00000021353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESSVKVIQIDVFMKRSEKPEGYRQMRPKTFPASNYTGSSRQMLQEIRESLRNLPKPSD
AAKAEHSMNKATIEDPRQGRNPPKFVTYHKALQEIRNSLLPFANEASSSTRSASEVNRQM
LQDMQIAGFDEDMVIRALRQTNNKSIEAAIEFISKMSYQDSRREQMAAAAAAARPVNAGP
KPPGNVQKSVNRKQSWKGSKESLVPQRHGPTLGESVVFRSESPNSQTDVGRPLSGSGIAA
FSQGHPGNGQRVNPPPPPQVRSITPPPPPPRGQTPPPKSTPPSSWEPNSQTKRYSGNMDY
MISRISPVPPGTWQDSYPPPPLNTSPLNPSSQGQRSINSVPVGRQPIIMQNSNNKFNFTS
GRSGIQNGSGQSDFMMHQTVVSGGSVNRQPPPPYPLSPTNGQSACTLQIQTGGPATSLPY
SNGNIPSSMMVPNRNSHNMELYNITVSGLQTSWPQSSSAPPQSSPGSGHEIPAWQPNIPV
RSNSFNNPLGNRPSHAANSQPSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWI
PQPIQTTQSIPFSESPTSTMAVMPPVAEAPNYQGPPPPYPKHLLHQNASVPTYESVPKPS
KEDQPCSPKEDEGEKNYENSDSGDKEKKQITTSPVPVRKNKRDEERRESRIQSYSPQAFK
FFMEQHVENILKSHHQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKM
DKSMFVKIKTLGIGAFGEVCLARKVDTNALYATKTLRKKDVLLRNQVAHVKAERDILAEA
DNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPENLARFYIAELTCAVESVH
KMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWG
DPANCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVIL
FEMLVGQPPFLAQTPLETQMKVINWQTALHIPQQAKLSPEASDLIIKLCRGPEDRLGKNG
ADEIKAHPFFKAIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSENNDEGNINDT
LNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPFEYNEYNNLQSSEQQSDEDDQHTG
TGVKNGDLVYV
Download sequence
Identical sequences F7FV88
ENSMODP00000020983 ENSMODP00000020983 XP_001370922.2.35504 XP_016284433.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]