SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021002 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021002
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.01e-52
Family Cyclophilin (peptidylprolyl isomerase) 0.0000314
Further Details:      
 
Domain Number 2 Region: 223-328
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.97e-29
Family Canonical RBD 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021002   Gene: ENSMODG00000016825   Transcript: ENSMODT00000021372
Sequence length 484
Comment pep:known_by_projection chromosome:BROADO5:2:429236864:429267595:-1 gene:ENSMODG00000016825 transcript:ENSMODT00000021372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLLETTLGDIVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPMGTG
RGGESVFVQLYGDQARFFEAEKMPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLD
GVHTVFGEVTEGMDVIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPAGLSIPDRSPE
PTKEQLDSGRIGADEEIDDFKGRSAEEIEEIMAEKEAKTQAILLEMVGDLPDADIKPPEN
VLFVCKLNPVTTDEDLEIIFSRFGPIKSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFK
MDNVLIDDRRIHVDFSQSVAKVKWRGKGGKYTKNDFKEYEKDQEKSKFALKDKVKPKQDT
KYDLVLDEETEDSRSSHSHSSKKHKKKTRHCSEEDYTTVKNSKDSSREWRHRRYEEECCK
EKRKSEKRERPQSRSRSRSRDKDVYHSNSKSKHRTEPYEREREKKRDKSRSPKKVRDKER
SKYR
Download sequence
Identical sequences F6R2R0
XP_007484771.1.35504 ENSMODP00000021002 ENSMODP00000021002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]