SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021006 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000021006
Domain Number - Region: 262-282
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0259
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021006   Gene: ENSMODG00000016829   Transcript: ENSMODT00000021376
Sequence length 318
Comment pep:known_by_projection chromosome:BROADO5:2:429164971:429205514:-1 gene:ENSMODG00000016829 transcript:ENSMODT00000021376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPHTEKLEFFRKLGYGQDDVVRVLAKLGQGALVNDILQELIQMGSRPQTEESCGESPAP
KLVSRGCGGSMDSSRQLLGMDPDEELEDPANHLRPIVIDGSNVAMSHGNKETFSCRGIRL
AVDWFRERGHNYIKVFVPSWRKEPPRSETPISEQHILEEMEKQAVLVYTPSRKVNGKRVV
CYDDRYIVKVAYEKDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDKFMPPDDPLG
RHGPTLSNFLSKKPKLPQPSWQHCPYGRKCTYGVKCKFYHPERLHQIQLSVADELRAKTR
TLPGSKGPASCTLGRSPP
Download sequence
Identical sequences F6R2P3
ENSMODP00000021006 13616.ENSMODP00000021006 ENSMODP00000021006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]