SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021022 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021022
Domain Number 1 Region: 83-173,239-274
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.96e-44
Family Inhibitor of apoptosis (IAP) repeat 0.0000218
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 7.72e-17
Family Inhibitor of apoptosis (IAP) repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021022   Gene: ENSMODG00000016844   Transcript: ENSMODT00000021392
Sequence length 300
Comment pep:known_by_projection chromosome:BROADO5:1:474691312:474701329:-1 gene:ENSMODG00000016844 transcript:ENSMODT00000021392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGPQDRVQCFCCGGMLDNWMAGDSPILEHQRFFPKCQFALSKHTGNIPAQDTSDSVDGQI
LSQLQRISEEGEGEGNEDTVTTRPVYPDMGVEQIRLASFHNWPSAAVVCPQQLARAGFFY
TGQHDHVKCYYCDGGLRNWDRGDDPWREHAKWFPRCEFLLQSRGRAYVNSIQDSSSLLDS
WGHGEDPQEVAPTSTPASVPMASESTPPRRESQPEQITETDPLSVFLYLCSLTLSTGPLS
TEQQLQQLKEERTCKVCMYQVVSIVFVPCGHLVCSECAPNLQQCPICRAAIHGSIRTFLS
Download sequence
Identical sequences F6QHU0
13616.ENSMODP00000021022 ENSMODP00000021022 ENSMODP00000021022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]