SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021068 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021068
Domain Number 1 Region: 170-441
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-83
Family Protein kinases, catalytic subunit 0.000000217
Further Details:      
 
Domain Number 2 Region: 75-213
Classification Level Classification E-value
Superfamily SH2 domain 2.91e-35
Family SH2 domain 0.0000165
Further Details:      
 
Domain Number 3 Region: 14-94
Classification Level Classification E-value
Superfamily SH3-domain 4.27e-19
Family SH3-domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021068   Gene: ENSMODG00000016881   Transcript: ENSMODT00000021439
Sequence length 453
Comment pep:known_by_projection chromosome:BROADO5:1:473705923:473724141:1 gene:ENSMODG00000016881 transcript:ENSMODT00000021439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRSLSHLGPKYLYISLWDFEARTENELSFQAGDLFHVMEKKEDWWRVTKLDATGKSLE
EGYVPHNYLAEQETMETEPWFFGQISRSEALHRLLVEENGTGTFLIRISEKPGADYVLSV
RDNQTVKHYKIWRNAEGKYYMNQTVSFPNLAGLVQYHKTKTLSHGLRLTTPCWKHEPKPL
PHWDDWERPREEFSLSRKLGSGYFGEVFEGYWKGKVKVAIKVIAKDDLMHQNTFYSEVEA
MKKLRHKHILSLYAISSTGDPVYIITELMPKGNLLELLRDPKGPKLPTTELVDIASQISE
GMCYLESQNYVHRDLAARNILVGENNICKVGDFGLARLIKDNIYLSYAQNIPYKWTAPEA
LTYGFYSTKSDVWSFGILLYEIFSGGQIPYPGMSNHEAHMKVLDGFQMHCPTKCPPSIYD
LMRRCWHLTPGERPCFKTLKEKLISFTNYENPL
Download sequence
Identical sequences F6Y152
13616.ENSMODP00000021068 ENSMODP00000021068 ENSMODP00000021068 XP_001376111.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]