SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021076 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021076
Domain Number 1 Region: 229-497
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-79
Family Protein kinases, catalytic subunit 0.000000226
Further Details:      
 
Domain Number 2 Region: 138-271
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-36
Family SH2 domain 0.00023
Further Details:      
 
Domain Number 3 Region: 66-183
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000112
Family SH3-domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021076   Gene: ENSMODG00000016887   Transcript: ENSMODT00000021447
Sequence length 514
Comment pep:known_by_projection chromosome:BROADO5:1:473616008:473687248:1 gene:ENSMODG00000016887 transcript:ENSMODT00000021447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQHWHPGGQSAVSMEPFLRKHLTFLSFFWDKLWPTSVPDDCIPRYPGPDPVTMDLDPDP
DPEPLSPKSSSPPPTVLFMALYDFTARCADELSVSRGDKLFVIKEEGDYIFARRLSGRPS
TGLVPINYVAKATQETFSDQPWYFDGISRSEAQQLLLSSSNQHGAFLVRPSESSRGDYSL
SVRMQAKVCHYRIAKAPEGGLYIQKGQVFPSLEELLIYYKANWKIIQTPLLQPCMQERPL
ERDEWERPRTEFALRRKLGEGYFGEVWEGLWLNKIPVAIKIIKSADMKLDDFTKEIQNLK
SLKHEKLIRLHAVCSIGEPVYIVTELMRKGNLQSFLNSPDGKALSIIHLMSIACQVAEGM
TYLEERHIVHRDLAARNILVGDDLTCKIADFGLARLLKDDIYSTKSSTKIPVKWTAPEAA
NYRIYSQKSDVWSYGILLYEVFTYGQCPYEGMTNQETIQQISRGYRLPRPPTCSPEVYVL
MLECWKGNAEERPAFFVLREKLSSIYRRLHHSFT
Download sequence
Identical sequences F6XJB6
13616.ENSMODP00000021076 ENSMODP00000021076 ENSMODP00000021076 XP_001376096.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]