SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021097 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021097
Domain Number 1 Region: 908-1007,1505-1682
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-37
Family Tandem AAA-ATPase domain 0.0027
Further Details:      
 
Domain Number 2 Region: 718-781,808-891
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-24
Family Tandem AAA-ATPase domain 0.0046
Further Details:      
 
Domain Number 3 Region: 436-524
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000174
Family Linker histone H1/H5 0.0054
Further Details:      
 
Domain Number 4 Region: 655-719
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000775
Family PHD domain 0.0056
Further Details:      
 
Domain Number 5 Region: 258-321,366-396
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000058
Family Tandem AAA-ATPase domain 0.02
Further Details:      
 
Domain Number 6 Region: 1434-1487
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000298
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021097
Domain Number - Region: 335-362
Classification Level Classification E-value
Superfamily WW domain 0.00668
Family WW domain 0.0062
Further Details:      
 
Domain Number - Region: 1018-1083
Classification Level Classification E-value
Superfamily TPR-like 0.0225
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021097   Gene: ENSMODG00000016900   Transcript: ENSMODT00000021469
Sequence length 1686
Comment pep:known_by_projection chromosome:BROADO5:2:424695527:424812908:-1 gene:ENSMODG00000016900 transcript:ENSMODT00000021469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRRKRAPPVRVDEEKQQQLRWNMHEDRKNEVLILDDDDQPVPGPSSSSVPFVVLDDDS
PEEEVTPKIKRRCSKSVSSLTDEEETACILPSILVKLNVVISPFHIDSSWKAFLGELTLQ
LLAEEILIESFHERKFTLMTADSSDQLQICVHPKCKEVEDQQKGLEELISVSEKSILVES
SFSNEMLEDLRWLQKKRIIELYHRPEGIQTIKVGIYLLEAGLAKPDFLSDGSGRIKKANQ
LIQKLMEKFYNFIIPDVLEEDEEESDSELERQNIEELYDFVRHTHQQEAQHLQENVQHPA
LIPVLRPYQSEAVNWMLLRENFRNSPANENALHFLWREVITTEGMTFYYNPFTGCIIREY
PNAGPQWPGGILADEMGLGKTVEVLALILSHTRQDVKQDVLTLPEGKLVNYFIPPQPAEG
SKKKKPKKMEFQSKEKIQYPSLRVMILAAVKEMNVKKGASIIAIFKYVSTIYRYDVQRNR
RLLKRNLEKLIAEQVVEQVKGHGLAGSFKLGKNYKEQKKCDRTKKQTTKSPRKSLNKFSD
EEKHQSESKDTVSENKEEKSLSSNITEEEHDYCEVSRDHGRLRKKRDQHSNEKLQPKAKE
LRSADLQRSSDLPSTHVTVSKSEPNSEEDNMKDQVSESQDHAGSEIPHANSISPFNTSDY
RFECICGELGLVDYKARVQCLKCHLWQHAECVNYKEENLKIKPFYCPHCLVAMKPVSTGA
TLIISPSSICHQWVDEINRHVRSSSLRVLVYQGVKKHGFLQPHMLAEQDVVITTYDVLRS
ELNYVDIPHSNSEDGRRFRNQKRYMAIPSPLVAVEWWRICLDEAQMVECTTAKAAEMALR
LSGINRWCVSGTPVQRGLEDLYGLVLFLGVDPYWVKHWWDQLLYRPYCRKNPQPLYNLIA
KIMWRSAKKDVIDQIQIPPQTEDVHWLHFSPVERHFYHRQHEVCCQDALAKLRKISDWAL
KLSSLDRRTVTSILYPLLRLRQACCHPQAVRGEFLPLQKSTMTMEELLTSLQKKCRTECE
EAHRQLVCALNGLAGIHIIKDEYPQAVDLYREVLRSSEEHKDKLKTDSLQRLHSTHNLME
LLLAKHPGIPPTLRDGKLEEEAEQLRQHYMSKSNAEVAEAHQALQPVLQIIRELQRKTHA
GSPWWLDVIQSAIQYAIDEELVQRVQNEITSNYKQQTSKLSMAEKFRDCRGLQYLLTTQM
EELKKFQKLVREAVKNLEGPPSRDVIEAATICHLRPVRLPLNNCVFCKADELFTEYESKL
FSHTVKGQTAIFEEMIEDEEGLVDDRLPTTSRGLWATSETERSLKAILSFAKAHRLDLRL
IEEGNTSMELFEAWKKEYKLLHEYWMVLRDHVSAIDELAMATERLRVRHPDEPKPNPPVL
HIIEPHEVEQNRVKLLNDKAVAKSQLQKKLGQLLYLTNLEKSQDKTTGGVNPEPCPICAR
QLGKQWAVLTCGHCFCNECIAIIIEQYSVGTRRSSIKCAICRQTTSHKEISYVFTAETAN
QEEDIPVKGSHSTKVEAVVRTLKRIQFKNPGAKSLVFSTWQDVLDIISKALYDNNMVFAQ
INGINRFQENLSAFKYDPKINILLLPLHTGSNGLNIIEATHVLLVEPILNPAHELQAIGR
VHRIGQTKPTIVHRFLIKATIEERMQAMLKTAERSHTSSSMKQSEASVLTVADLADLFTE
ETEELE
Download sequence
Identical sequences F6X169
ENSMODP00000021097 ENSMODP00000021097 XP_001370692.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]