SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021120 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021120
Domain Number 1 Region: 131-375
Classification Level Classification E-value
Superfamily SET domain 6.02e-78
Family Histone lysine methyltransferases 0.0000149
Further Details:      
 
Domain Number 2 Region: 34-96
Classification Level Classification E-value
Superfamily Chromo domain-like 1.29e-19
Family Chromo domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021120   Gene: ENSMODG00000016930   Transcript: ENSMODT00000021493
Sequence length 410
Comment pep:known_by_projection chromosome:BROADO5:8:139405064:139421290:1 gene:ENSMODG00000016930 transcript:ENSMODT00000021493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAGARGAWCVPCLASLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKIEKD
MEYYLVKWKGWPETTNTWEPSRNLKCPLLLEQFYNDQRDYLSQLKQGKAVMLKNDIKSLK
PAIAEYVVKKAKQRVALQRWQEELNRKKNHKGMIFVENTVDLEGPPLDFYYINEYKPAPG
INLTNEAIVGCMCTDCFFEKCCPAEAGVHLAYNKKRQIKIQPGTPIYECNSRCKCGPDCP
NRIVQKGTPYSLCIFRTSNGCGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQLYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TIHPGEELTFDYQMKGSGDISSESIDLSPAKKRVRTVCKCGSVSCRGYLN
Download sequence
Identical sequences F6VMZ7
ENSMODP00000021120 XP_001369042.1.35504 ENSMODP00000021120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]