SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021152 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021152
Domain Number 1 Region: 7-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.05e-56
Family G proteins 0.000000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021152   Gene: ENSMODG00000016955   Transcript: ENSMODT00000021525
Sequence length 213
Comment pep:known_by_projection chromosome:BROADO5:2:190908673:190927995:1 gene:ENSMODG00000016955 transcript:ENSMODT00000021525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVLLGTAA
VKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVV
MLVGNKSDLSQAREVPTDEARMFAENNGLLFIETSALDSTNVELAFETVLKEIFTKVSKQ
RQNNSRANAVTLSNAQPGQELGSVERKACCISL
Download sequence
Identical sequences F6V5N3
ENSMODP00000021152 13616.ENSMODP00000021152 ENSMODP00000021152 XP_001367187.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]