SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021169 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021169
Domain Number 1 Region: 1443-1750,1821-1922
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.86e-85
Family RNB domain-like 0.0000818
Further Details:      
 
Domain Number 2 Region: 2363-2456,2494-2844
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.49e-61
Family Extended AAA-ATPase domain 0.063
Further Details:      
 
Domain Number 3 Region: 767-1205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.38e-46
Family Extended AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 4 Region: 1304-1377,1405-1469
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000105
Family Cold shock DNA-binding domain-like 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021169
Domain Number - Region: 287-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00226
Family HkH motif-containing C2H2 finger 0.088
Further Details:      
 
Domain Number - Region: 334-362
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0497
Family CCCH zinc finger 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021169   Gene: ENSMODG00000016966   Transcript: ENSMODT00000021542
Sequence length 2869
Comment pep:known_by_projection chromosome:BROADO5:1:473540911:473577328:1 gene:ENSMODG00000016966 transcript:ENSMODT00000021542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLKKGLLARLQSQLDLCVGCSVCSQALNESTYITHTIEHNCPREILLARAKGAPEHKE
WRKVGRRPSFPRPRRYEVCRYYKPGMGCRKHHNQCTFARSPEEALVWTFERENNIPRLWL
KAEVQGSLYQGTPRILTAAEEIGAEFGGNFQELCKPCFRKCPPQVTFRGPNLPCPQHRAS
SLLIIHITSEGLRKKQLVEIRPKPWPGRVLEYCMYVSRGYPCRHGAIRCQYAHSDVEMAV
WEAESMGCLTRSELLKLPATLESGIGAGTSGEDGGRNGSSSAPPQIQLYCRACLVTCNSQ
ESFENHCSSLEHTQMVAYDKGTLWEYRAPPIGLRKFKLCSRLDICEYGNGCTQAHSVEEL
QEWILRAQAAQMREESARQDGLLSYQDRLLHEYQHCNNEMLVMSESIGDVTVHCDQPLQC
HVEDKKSQCRWKFIIQSKDPLQHVALLKRQTGAVFSLVIPGLPPGQLYAHGSRFHMQGAV
MTFQVEVLVECIAFGSYEQWVAFDFGCRPVLVRKLHVQVGQRKTAGISPTCPQDHDCLME
LIRWHSGNRCVVPSVARADEQMRLLAKYKLNPQQLEYYMSMASDHIPITPVNYRDRMHQF
LYVEEEAQQQLVAKLNLQVQVTLTSKMQTLAMGLKCAAPGELFAKVPIPCSLTPDTDQGY
LLSRAVNTAYVAPVPAPDNRVYEVQVEVKATSDQNVWLLLPAHCCSALGLKDEDTKLMEI
QFQIDRTVFGIWHQAIDALQDDKLVTPNMSACSLPSLRPPPQELRGNPKQKQAISFITGI
ASPLSRVPPLLIYGPFGTGKTYTLAMATLEVMKQPNTKVLICTHTNSAADIYIREYFHAY
VTAGHPEAVPLRVKSTESFLNQTDPTTLQYCCLTDDRRFFRDPTQAELKQHRIIITTTTL
SRSLDVPPGFFSHILIDEAAQMLECEAIIPLAYATRNTRIVLAGDHMQITPKLFSVGDRK
SADHTLLNRLFQYYQRENHELAFQSRVIFHENYRSTKAIISFVSRNFYVAKGNPIQASGQ
IPGHPEKHPLMFCHVAGTPERDITMTSWFNRAEIVEVIEKVQEFYSIWAYQWNSPDLKQI
CVVSHGSQVKTLRQELRKKQLGEVAVENFENLPGREFRVIILSTVHTRDSLLSSSVPHLE
FFSEARVLNTVMTRAQSQVVAVGDAVALCSFGRCSKVWKHFIQECVEMRSVSPVDLTMEQ
IKQDVAHRQRWARQNGLHPVKIAMEDYLEEEDNDNDTASWVSDAELNADDPILQELLDES
KNVAVTVTEDGLLNVTSGARTHHQGQQYLSFPVPVLQKYLRMQPKIYRKCELIKEAFEKA
SAFTIDDSPPLIIQIRGRTNCGMAFTGDQVLVEILTPELEEQGYSWRPMGRVVGVLERGD
RELIFICKMDEFDPRVMIPIDPSVTKIFVPELKDKPNTIPIRRLQRGHIKLISYEKITEE
TKRNQLFRVQIISWKERFYYPLGIILEILPLPLTLEQGLKILDMEYSLSANGRYPTPVIK
EVNQHNYSKFSLRQGQWKDCRDYLTFTVDPQGSRDLDDAISVRDLGTQYEIAVHISDVAS
FMPKDGALDREARKRGATYYAPGKDPVAMLPSRLSQDLFSLLPHQERRTISLILTVEKEG
DQVVKWHITPSMIRSDLQLTYEEAEVIIKSHPGGGAWLPLRLGTVEGCVVAAYHFSQVLR
RGRLKGDCYYDQPDEDSPLGSRSSHQMVEELMILFNSYVAKFLVHKDSTKSITPLRCQAE
PNPQQVGQLKEKYRHLLPVSLHLSYRLCGQPYNASQVNSSVCNLSILCPLWDHLCQAADS
KDYNKMVDLIATDDIHPTLAPAGLEFRKLLSRSYFSRSNSTSLSRAGHYSLQVDWYTWAS
SPIRRYIDVVLQRQLHAAMGQGQPGYSPEDIDLLCHDFNRKNGRAQAYERKAHCLHLATQ
LKAQLLTKLCFVVNVESANRFFKVIFPMNRDTLPDPHLVNYRALQLVEQPSFIPERQNIK
LVWKKRMYSLDKGKAWTPSPKTLVDTHVMPVSSSIWQDLLLAIQNQNFQKAAALLLRSRG
TAQNSYRRPIGQMSRSKCSHYVEVVLELSTGDALQMQLTTDVQRGFLVPSIQMWMLTPSF
AICLEHAEKPIDCFSRYASQATKDVYSDPQDYSRVWKPLSAMESASSAVAENDSILLYGV
PITWDRERNSQGQMQGTFYLTYTFLKECAIDINFNFCYLCIRMENLKLQGPVEEEEKGEE
TALIQNFKKLSLCRKAVDPPMVNTLDSCLNVDPDTYTWVAHGLTDEMDQDAKKVDRREER
TTIHFFLHHVSMENIPVEVTRKGACFTIEMIPKLLPDIRKEKAIWKLQYASPLITSIALG
QPIKEGSYKTIKSSILKHRTFDIPQGKFKLNKSQNSAVLEALQKPFTLIQGPPGTGKTVV
GVHIVYWFNKLNQEKPETDPLPLTGDNKNRGEKCILYCGPSNKSVDVVSEILLQWKEELK
PLQVYSEQMEAMEFPVPGSYRKMFRKNTREGKPKPELRDIVLHHRIRMPSNPFFRKIIEF
DARVRKGDQFSEDEIEEYKSITKLARMVELKNHGIILCTCSCAASSILVKHLNVKQILID
EAGMATEPESLIPLVNFPQAEKVVLLGDHKQLQPFVKNDHCQNLGLEKSLFERYHGQAWM
LDIQYRMHNDICRFPSKEFYDNKLKTSLKLKRMPSVFCHPDQVSCPIIFGYVQGVEESLL
VSTDEGNENSRANRDEVDHVVRIANQLTLDRTIKPKDIAILSPYNAQVSEINKRLLKEGI
TGVTVSSIKKSQGSEWRYVILSTVRSCPPGEIDGRPTKSWLKKHLGFVSDPHQVNVGITR
AQEGLCIIGNHYLLSCCPMWQRLIDFYTKKGCCVMASSVQVRQRSAVRH
Download sequence
Identical sequences F6UMR7
ENSMODP00000021169 XP_007475616.1.35504 ENSMODP00000021169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]