SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021225 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021225
Domain Number 1 Region: 222-260
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000114
Family Tudor domain 0.018
Further Details:      
 
Domain Number 2 Region: 177-202
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000691
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021225   Gene: ENSMODG00000017016   Transcript: ENSMODT00000021598
Sequence length 539
Comment pep:known_by_projection chromosome:BROADO5:1:473195840:473210044:-1 gene:ENSMODG00000017016 transcript:ENSMODT00000021598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLCRMDENSVEASIQTYHVQLQQVELALGTGLDPTEKADLLQLQADLKQLIELTESSLVS
IKKSKLLATLDPSLGLIESAVRDEAEYLAFQNAIREVTGDSETQGAETATSPKRGETEPD
RAGHEEEEEEELSGMKVNAPYYSSWGTLEYHNAMIVGTEHSEDGTAGVRVLYLYPTHKSL
KPCPFFLEGKCRFKENCRFSHGQVVAVDELRPFQEPDLSALHTGSACLAKYDDGIWYPAR
ITDVDSGYYTVKFDSLLLKETVVEGDGIMPPLRSEDNTPSESDGDDVDDSSYAKVVESDA
LEKGDWGPACSSSFAGWEAHTRGIGSKLLTQMGYEFGKGLGKNAEGRVEPIHAVVLPKGK
SLDQCAEILQKRTSSKPDLGKPRKSQAKGNGAKGRPPQRNVFDFLNEKLQGKAPRVQEEG
KVASLKRNSKELYHASKSTKRSLSVQLFQILEKVEQTQRDIRSIQEALARNIGRYNSLTQ
RPTSIDLLYPRWPGGIKADVQMTTVPPVFIHRELPQPPLALDFLAIESTYSNVREAAVP
Download sequence
Identical sequences F6QEZ5
ENSMODP00000021225 ENSMODP00000021225 13616.ENSMODP00000021225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]