SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021340 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021340
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.97e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 25-75
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000618
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021340
Domain Number - Region: 265-341
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00968
Family Apolipoprotein A-I 0.022
Further Details:      
 
Domain Number - Region: 167-202
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0188
Family TFIIH p44 subunit cysteine-rich domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021340   Gene: ENSMODG00000017100   Transcript: ENSMODT00000021714
Sequence length 480
Comment pep:known_by_projection chromosome:BROADO5:2:189855358:189861057:1 gene:ENSMODG00000017100 transcript:ENSMODT00000021714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMERELLCPVCQEMYKQPLVLPCAHNVCQACAREV
LGQQGYGSHTGDPSSEPTSPASTPATRSPRLGRRTLPKADRLDRLLKSGFGTYPGRKRGA
LHPQMVTFPCPACQGDVELGERGLGGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
EATKGCTECRATFCNECFKLYHPWGTQKAQHEPTLPTLTFRPKGLMCPDHKEEVSHYCKT
CQRLVCQLCRVRRTHSGHKITPVLSAYQALKEKLTKSLTYILGNQDTVQTQICELEETVR
HTEVSGQQAKEEVAQLVRGLGAVLEEKRTTLLQAIDECQQDRLARLGAQLQEHRSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHHRIARATEALQNFRPATSSSFRHCQLDVGREMKL
LTELSFLRGCGHGRVCSGAPQASHWPLPRGPCPPPLPGPLSYLPCPLQELPLIPTPVWFS
Download sequence
Identical sequences F6UKH9
XP_007482182.1.35504 ENSMODP00000021340 ENSMODP00000021340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]