SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021348 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021348
Domain Number 1 Region: 502-632
Classification Level Classification E-value
Superfamily PABC (PABP) domain 1.7e-52
Family PABC (PABP) domain 0.000000502
Further Details:      
 
Domain Number 2 Region: 190-374
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.33e-50
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 3 Region: 10-179
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.47e-49
Family Canonical RBD 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021348   Gene: ENSMODG00000017105   Transcript: ENSMODT00000021722
Sequence length 635
Comment pep:novel chromosome:BROADO5:X:24038699:24040606:-1 gene:ENSMODG00000017105 transcript:ENSMODT00000021722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPSAPSYPTASLYVGDLHPEVSEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALETMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALFDTFS
AFGNILSCKVVCDEHGSKGYGFVHFETRDAAERAIDKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDLRLKRLFGKFGPSLSVKVMTDESGTSKGFGFVNFER
HEDAQKAVEEMNGKELNGKKIYVGRAQKKGERQTELKRKFEQLKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRNKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYIALAQRKEERQAHLTNQYMQRMASIRAVPNPVLNPYQPPSGYFMTAIPQTQNRPAY
YPASQMAPLRPSPRWTSQGARPHPFQNLPGAIRPAASRPPFGSMRPMSSQLRGVGASQRI
ANSSTQALGLPPGASAGAAGAPGVRMGPQYKYAAGVRNPQQHVNIQPQARVQQPAVHVQG
QEPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPE
SLRSKVDEAVAVLQAHQAKEAAQKAVKNAADVPAV
Download sequence
Identical sequences F6UKA6
ENSMODP00000021348 13616.ENSMODP00000021348 ENSMODP00000021348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]