SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021388 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021388
Domain Number 1 Region: 126-315
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-63
Family Phosphotyrosine-binding domain (PTB) 0.00000000623
Further Details:      
 
Domain Number 2 Region: 464-570
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-27
Family SH2 domain 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021388   Gene: ENSMODG00000017139   Transcript: ENSMODT00000021763
Sequence length 577
Comment pep:known_by_projection chromosome:BROADO5:2:189580274:189587919:-1 gene:ENSMODG00000017139 transcript:ENSMODT00000021763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKPKYNPLRNESISSLEEGTLGSLSPGELSSPSASSLGPILPSMLGDESPTTLCS
FFPRMSNLKLANPTGGRLGPSEETGQGPEDRERNAGGAGLDSGPSPLLQDMNKLSGGRRT
RVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFN
TRTQVTREAISLVCEAVPGAKGAARRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLN
LMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVIS
TIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEDPPDHQYYNDFPGKEPPLGG
VVDMRLRDGPAPGSPWPPTPNTQTTNHLGATLPVGQLAGGDPDIRKQLPTPGPGRELFDD
PSYVNVQNLEKVRQGAGGPSNPTTNGSAPRDLFDMKPFEDALRVPPPSPTPPMAEQLRAE
PWFHGKLNRREAEGQLRLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKD
HRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences F6TMP1
ENSMODP00000021388 ENSMODP00000021388 XP_001366479.1.35504 13616.ENSMODP00000021388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]