SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021450 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021450
Domain Number 1 Region: 396-501
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-22
Family SH2 domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021450   Gene: ENSMODG00000017195   Transcript: ENSMODT00000021826
Sequence length 519
Comment pep:known_by_projection chromosome:BROADO5:2:188784975:188866443:-1 gene:ENSMODG00000017195 transcript:ENSMODT00000021826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVAPAPGVSRCLGFASLLAGSGSKGATTLTGRAPPMAAKWFKEFPLTLKTVSERAKPGS
GGGGGGGGGTGGGGSLASKLRKNSEAGGPGLPPPSGKSRKNSAAELGSCKVAGAGGPAKD
SRLSRDSIQGMLQAAAGKSRKNSRTTAVAAAPEEEQPRGSVKSTGCSTYINRLIKVDTQE
KNGKSYSSSTSSSSSSSSTSSSPSSLGPELDKGKGVKQQDTVIILEDYADPYDAKRTKGQ
RDAERVGENDGYMEPYDAQQMITEIRRRGSKDPLVKAIQLLDSPCESGENGIKSETLAKR
RSSKDLLGKPPQLYDTPYEPGEGGPKPDVQMGTERKMRAPDSRLPENDERPAAEYEQPWE
WKKEQIVKALSVQFEGSERPSIKEETVRHHHRQKSWTQKMLKPALSDHSEGEKVDPAICL
EKQPWYHGSITRAEAESRLQPCKEASYLVRNSESGNSKYSIALKTSQGCVHIIVAQTKDN
KYTLNQPSAVFDSIPEVVTLRRWGFLSTAVTVILVGGSG
Download sequence
Identical sequences F6XFR4
ENSMODP00000021450 ENSMODP00000021450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]