SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021460 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021460
Domain Number 1 Region: 243-310
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000117
Family Splicing factor U2AF subunits 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021460
Domain Number - Region: 309-337
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 175-199
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000249
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021460   Gene: ENSMODG00000017202   Transcript: ENSMODT00000021836
Sequence length 470
Comment pep:novel chromosome:BROADO5:7:24227504:24254659:-1 gene:ENSMODG00000017202 transcript:ENSMODT00000021836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGILKMAAPAVLPLAEKPNHKKYRAALKKEKRRRRRQERARLRDSGLSQKDEEEEESIVE
LEEEEKQLEAERQKLHEEWLLREQKAQEEFKLKKEKEEAAKRRQEEEEADNSKSEWEQGR
KSNGQNNIETRCELPDFKEAVQKMLDQAESQLENGVTWHNPEPPVDLRATEKDQANCPFY
IKTGSCRFGDRCSRKHNYPTSSQTLLIRSMFITFGMEQCRRDDYDTDASLEYSEEETYQQ
FLDFYEDVLPEFKNVGKVIQFKVSCNFEPHLRGNVYVQYQSEEECQAAFSLFNGRWYAGR
QLQCEFSPVTRWKMAICGLFGRQKCPRGKHCNFLHVFRNPNNEFWEANRDIHMSPDWANT
SFGKSSERRDRTSYHEEYYSRSRRRRSPSPDHSYKRNGESERKKSNHHRSKKKSHKHSSK
SHERRRSRSRGRKRDRSRRSRSQSRSRRSQSKSASRSRSRDRKRSTSRDR
Download sequence
Identical sequences F6XEZ3
ENSMODP00000021460 13616.ENSMODP00000021460 ENSMODP00000021460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]