SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021490 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021490
Domain Number 1 Region: 411-675
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-76
Family Protein kinases, catalytic subunit 0.0000000137
Further Details:      
 
Domain Number 2 Region: 56-197
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-44
Family Pleckstrin-homology domain (PH domain) 0.0000459
Further Details:      
 
Domain Number 3 Region: 298-444
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-32
Family SH2 domain 0.0000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021490   Gene: ENSMODG00000017228   Transcript: ENSMODT00000021866
Sequence length 682
Comment pep:known_by_projection chromosome:BROADO5:7:24578410:24660964:-1 gene:ENSMODG00000017228 transcript:ENSMODT00000021866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSFQASQLPKRKKPARAYRGDRCFFSFTTCQLILIGMDPNKMKPAEMDDNMDKKTVLEE
LLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYDYDKMKRGSKKGSIDIKKIRCVERVNLE
EQTPVERQYPFQIVYKDGLLYVYASNEESRSKWLKALQKEIRGNPHLLIKYHTGFFTDGK
FLCCQQSCKAAPGCTLWEEYANLHVESIPVKPVLHPIIPHRLLKIPRAVASLPPHESSPK
STTEEFDSEKRRNESSEMGANTRGGNAVSGIPLKKHVQIPMISWGVPGSSSSEEEENLSS
YDWFAGDISRAQSEQLLRQKGKEGAFMVRNSSQAGRYTVSLFSMALNDKKGTVKHYHVHT
NAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKVNKVPLTASLGSGIWELK
REEITLLKELGYGQFGVVRLGKWKGKYDVAIKMIKEGSMSEDEFIQEAQTMMKLNHPKLV
KFYGVCTKMYPIYIVTEYITNGCLLSYLKQHGKELQPFQLLEMCYNVCEAMAFLESQQFI
HRDLAARNCLVDSDLSVKVSDFGMTRYVLDDQYVSSIGTKFPIKWSAPEVFHYSKYSSKS
DVWAFGILMWEVFSLGKQPYELYDNRQVVTKVSQGYRLYRPQLASDNTYQIMYSCWHELP
EKRPTFHQLLSSIDTLREDDKP
Download sequence
Identical sequences F6WX83
ENSMODP00000021490 XP_007500943.1.35504 ENSMODP00000021490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]