SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021491 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021491
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily UBA-like 1.29e-32
Family UBA domain 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021491   Gene: ENSMODG00000017227   Transcript: ENSMODT00000021867
Sequence length 1088
Comment pep:known_by_projection chromosome:BROADO5:2:188553416:188594138:1 gene:ENSMODG00000017227 transcript:ENSMODT00000021867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVGTNRARGNWEQTQTQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDI
TGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQMESNEEG
KENRDRDRDYSRRRGGPPRRGRGSSRGREFRGQENGLDGAKTGGPSGRGTERGRRGRGRG
RGGSGRRGGRFSAQGMGTFNPADYAEPTNTDENYGNSSGNTWNNTGSFEPDDGTSAWRTA
TEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQRIDLAVLLGKTPSSMENEST
NLDPSQAPSLAQPLVFSNSKQSTMSQPASGSTFSHHSMVSMLGKGFGDVGEAKGGSTTGS
QFLEQFKTAQALAQLAAQHSQSSGSTTTSSWDMGSTTQSPSLVQYDLKNPTDSAVHSPFT
KRQAFTSSSAMMEVFLQEKPPAVTTSTAVPPAPSSPLPSKSTSAPQMSPGSSDNQSSSPQ
PAQQKLKQQKKKASLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSEYESTPTTS
ASSSQTPSSLYTSTASESSSTISSNQSQESGYQSGPIQSTTYTSQNSAQGPLYEQRSTQT
RRYPNSISSSPQKDLTQAKNGFSSVQATQLQTTQSVEGATGPAVKSDSPSAPTIPPLNDT
VSAASLLTTANQHSSALGGLSHSEELPNTTTTQHSSTLSTQQTTLSSSSSSGRTSTSTLL
HTSVESEASLHSSSSTFSTASSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSS
VATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPF
PTPTTPLTGRDGSLASNPYSGDLSKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLN
PALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSG
YGSHGYNTGVSVTSSNTGVPDISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPI
NPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQTGSGQRNQTSSIPQKPQNSKSAY
NSYSWGAN
Download sequence
Identical sequences F6WHV1
ENSMODP00000021491 XP_001366202.1.35504 ENSMODP00000021491 13616.ENSMODP00000021491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]