SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021519 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021519
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-80
Family Calponin-homology domain, CH-domain 0.000000474
Further Details:      
 
Domain Number 2 Region: 2854-2978
Classification Level Classification E-value
Superfamily EF-hand 1.6e-49
Family EF-hand modules in multidomain proteins 0.00000581
Further Details:      
 
Domain Number 3 Region: 2980-3075
Classification Level Classification E-value
Superfamily EF-hand 9.07e-37
Family EF-hand modules in multidomain proteins 0.0000176
Further Details:      
 
Domain Number 4 Region: 1932-2088
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 3055-3143
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 312-419
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-20
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 2517-2647
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-19
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 2293-2451
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-18
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 9 Region: 494-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 10 Region: 965-1084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000101
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 11 Region: 1182-1334
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000288
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 12 Region: 2670-2809
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 13 Region: 427-527
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000964
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 14 Region: 744-902
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000157
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 15 Region: 2063-2186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000589
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 16 Region: 2816-2853
Classification Level Classification E-value
Superfamily WW domain 0.000000000113
Family WW domain 0.00024
Further Details:      
 
Domain Number 17 Region: 1433-1543
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000176
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 18 Region: 1493-1648
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000688
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 19 Region: 1621-1746
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000976
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 20 Region: 1081-1193
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000121
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021519
Domain Number - Region: 1307-1397
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000792
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 2246-2309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0345
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 1779-1847
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0471
Family Spectrin repeat 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021519   Gene: ENSMODG00000017210   Transcript: ENSMODT00000021895
Sequence length 3445
Comment pep:known_by_projection chromosome:BROADO5:2:422596547:423250600:1 gene:ENSMODG00000017210 transcript:ENSMODT00000021895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEQENRPNEGQNEFSDIIKSRSDEHNDVQKKTFTKWINSRFSKSGKPPIKDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDIMSDLQQTNSEKILLSWVRQSTRPYSQVNVLNFTTSWA
DGLAFNAVLHRHKPDLFNWDRVTKMSPIERLEHAFNKAQKHLGIEKLLDPEDVAVPLPDK
KSIIMYLTSLFEVLPQQVTMEDIREVETLPRRYKKECEEEEFSVQTTAPEEEEHEGSRAE
TPSTVTEMDMDLDGYQVALEEVLTWLLSAEDTFQDQDDISDDVEEVKEQFATHEEFMMEL
TAHQSSVGSVLQAGNQLITQGTLTDEEEFEIQEQMTLLNSRWEALRVESMDRQSRLHDVL
MELQKKQLQQLSDWLTLTEERIQKMETCPLDDDLQSLKKQLEEHKELQNDLETEQVKVNS
LTHMVVIVDENSGESATAVLEDQLQKLGERWTAVCRWTEERWNRLQEINVLWQELLEEQC
LLKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVCQ
LLDNPRTSKKINSDSEELTQRWDSLVQRLEDYSNQVTQAVAKLGMSQVPQKLLLETVGIR
EKVTVKKSKQELPPPPPPKKRQVHVDLDAKKKFDAVSTELLNWISKSNSAIQAIDIKEYK
KTRDTLDMKKKLKVLEKEQTERIPKLNELKHRGQNLLEQMGKEGISADDVKKVLEKVQSE
WKDVVWNLEDVSRKIQLQDDINTFFKDLDELEKAIKEKEEWVENSSIADTTQQFGPNLKD
TCQWELTHLLSLGPQIEMMSSSCMALMSQPSAPSFIQKSLESFIDRYKSVQQNLEECQKQ
LEKDLKSQPGDDYLQTLKTVKDVLNESENKTQISLNALNDLSEVEKALQEKRALEQILED
QKPLLGKLEEETKTLEQGAPHDIKNKYRHEFENVQGKWDRLKARVSKDIHLLEEIIPKLR
VFEADSKVIEKWINGVKDFLMKEQAIQGDSEGLQRQLDQCRVFVNEMETIDSSLKEMKEI
ESALRSHPVAGVKTWVQTILVDHQSQWEKFSKQIAIQKNKLSESQEKAMNLKKDLAEMQE
WMTQAEEEYLEKDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDSIKLLAAKVPSG
GEELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLELETTWLNTLEERVQST
ESLPEKADALNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLETFNSRYE
ELSHLAESRQILLEKQLQTMRETDHMLQVLQESLTELDKQLTTYLTDRIDAFQVPQEAQK
IHAEISAHELTLEELRRNNRSQPPTSPEGRSPRGGSQIDMLQRKLREVSTKYQLFQKPAN
FEQRMLDCKRVLDGVKADLHVLDVKDIDPDIIQSHLDKCMKLYKTLSEVKLEVETVIKTG
RQIVQKQQTDNPKGMDEQLTSLKFLYNDLGAQVTEGKQDLERASQLARKMKKEVALLSEW
LAVTEAELVQKSTSEGLLSDLDTEIAWAKNVLKQLEKRKFDLNNITEIRVALQGLVEGSE
ATLEEKICVLNAGWSRVRTWTEDWCNTLLNHQSQLEIFDGNVAHISTWLYQAEALLDEIE
KKPVNKSEEIVKRLTSELDDVNLQVENVRDQAITLMSARGLASSELVEPKLAELNRNFEK
VSQHIRSAKMLINQELFSKKIFVKSQPFETGVPSADLDKLEHDLQNMLKVVEKHSDEDEK
LDEEKAQIEEVLQRGEQMLQHPMEDNRREEIRLQLLLLRTRHNNVKATPIQQMVTDQYSS
GIRSTPLPVDYLVEINKVLLAMGDVELLLNSPELNTGIYEDFSLQEDSLKVEYMNHPIDE
NIKDHLDKLGEQIAVIHEKQPDVILEASGPEAIQIGDTLTQLNAKWDRLNRMYNDRKGCF
DRAVEEWRHFHCDLNDLTQWVAEAEQLLADSHTADGILDIEKARIHQQELEEGVSSHQPS
FSSLNQTGEDIIQKLSTADGSFLQDKLAGLNKRWNSIMTEVMERQQRIKGENEKLLEFRK
RLTEMSCWLSKTESTLEKIPSSENEDSIQELKDLTQQIEVQEENLKWLNRSEPEILLVNN
LNLQERDYISENLRTLNIKWNKIYREVPSALRERELDVSEPCPVMHPKLSAYPAIQKVVL
VSSTSEVLDQTQPSLELSVPADLDKTTTELADWLVLIDQMLKSNIVTVGNAEEIKQTIER
MKITKADLEQRHPQLDYVFTLAQNLKNKTSSSDIRTAITEKLEKVKNQWDNTQHGVDVRQ
QQLQDMLVDSEQWNDLREETEELITQHEAKVHSVLKVPKEPLIRQLSENKMLIQELNKGE
VTMAAFSNLLKKLLRDYSGDDTRKVNETYDHLNASWINLNQSLCDRQNALEAELRTVQAS
LKDLESFLKWMPEAETTVNVLADAAQRENALQDAGLVKELRKQIQDIQAEIDAHNDIFKS
IDGNRQKMVKALGNSDEAALLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLTSL
EELIKWLNMKDDELKKQMPIGGDVPALQLQYDHCKALRRELKEKEHSILNAVDQARVFLA
DQPIEAPDEPRRNLQSKIELTPEEKAQKIAKAMRKQSSEVKEKWENLNAVTSSWQKQVDK
ALEKLRDLQGAMDDLDADLKEAETVRNGWKPVGDLLIDSLQDHIEKTTAFREEIAPINLK
VKTVNDLSSQLSPLDLHPSLKMSRQLDDLNMRWKLLQVSVEDRLKQLQEAHRDFGPSSQH
FLSTSVQLPWQRSVSHNKVPYYINHQTQTTCWDHPKMTELFQSLGDLNNVRFSAYRTAIK
IRRLQKALCLDLLELNTTNEIFKQHKLNQNDQLLNVPDVINCLTTTYDGLEQSHKDLVNV
PLCVDMCLNWLLNVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRCLFKEVAGPTEMCDQ
RQLGLLLHDAIQIPRQLGEVAAFGGSNIEPSVRSCFQQNHNKPEISVKEFIDWMRLEPQS
MVWLPVLHRVAAAETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHK
LHYPMVEYCIPTTSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPIT
LISMWPEQYDPSQSPQLFHDDTHSRIEQYASRLAQMERTNGSFLTDSSSTTGSVEDEHAL
IQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIADLEEEQRSLQVEYEQLKEQH
LRRAMSPLSSPPDSIAPPHHTAEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLH
RLRQLLEQPESDARINGVSPWSSPQHSALGYSLDQDSSSQLQTAVADDLLVPPHNTSTDL
TDVMEQIHSTFPSCCSNLPSRPQAM
Download sequence
Identical sequences F6TL92
ENSMODP00000021519 ENSMODP00000021519 XP_007484743.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]