SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021564 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021564
Domain Number 1 Region: 168-261
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-21
Family Canonical RBD 0.0000195
Further Details:      
 
Domain Number 2 Region: 13-106
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.66e-21
Family Canonical RBD 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021564   Gene: ENSMODG00000017283   Transcript: ENSMODT00000021940
Sequence length 332
Comment pep:known_by_projection chromosome:BROADO5:1:28588246:28598694:-1 gene:ENSMODG00000017283 transcript:ENSMODT00000021940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWVMKHNGPNDAASDGTVRLRGLPFGCSKEEIVQFFTGLEIVPNGITLTMDYQGRSTGE
AFVQFASKEIAENALGKHKERIGHRYIEIFKSSRSEIKGFYDPPRRLLGQRPGPYDRPLG
GRGGYYGAGRGSYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGFHGG
HFVHMRGLPFRATENDIANFFSPLNPIRVHIDIGADGRATGEADVEFVTHEDAVAAMSKD
KNNMQHRYIELFLNSTAGGGSGMGGSGMGGYGRDGMDNQGGYGSVGRMGMGSSYSGGYGT
PDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY
Download sequence
Identical sequences F6SMV1
XP_007478322.1.35504 ENSMODP00000021564 ENSMODP00000021564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]