SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021643 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021643
Domain Number 1 Region: 289-416
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 418-522
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-25
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 3 Region: 62-155
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-17
Family PDZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 200-283
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000014
Family Ras-binding domain, RBD 0.04
Further Details:      
 
Domain Number 5 Region: 33-64
Classification Level Classification E-value
Superfamily WW domain 0.000000811
Family WW domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021643   Gene: ENSMODG00000017342   Transcript: ENSMODT00000022020
Sequence length 1314
Comment pep:known_by_projection chromosome:BROADO5:7:28711174:28988590:-1 gene:ENSMODG00000017342 transcript:ENSMODT00000022020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTMCVCFVYSHRTKASGWPPPSGTWSLNQVPPYGWEMTANRDGRDYFIDHMTQGVTFED
PRFDSCQIIPPAPRQVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVMI
NDEPVSTAPRERVIDLVRNCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSEE
VIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKCIE
HFSLMLEQRMEGAVTRLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPV
AFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLE
TFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRV
FKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEDEGSIRVE
LHVLDVKPIILLMEPSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNAGNRETGPENKGK
HNLLGSDWNCVPQMTTFIADGEQEPQITYIDSKHKNVDIADDTLCPKDHRHLYIEDTYHS
DDLDHRLTQQGDSSCEMESRGLAQQSLLSLSGLETSQKAQDSPRSAKVSFIFGELALDDI
NPQNLGYERLLDESPEMLEKQRALYLSNTNDIKGLDLSPDAESIQFVTNSVYANISDGKN
FEAAEGIEEPLLHEICYSENTDDAEDEDEVSCEEDLVVGEINRPAILNLSGSSDDIIDLT
SLPPPEGDDNEDDFLLHSLNMAIAAPPPGFRDSSDEEDSQHQTTQFREDKEQASSLQNDE
IPVSLIDAVPTSSEGKCEKGLDDAVVSTLQALEALAASEEQQTNDNSGVAILRAYSPESS
SDSGNETNSSEMTESSELATAQKQSENSTRMFLATSDGYHPLVEEQTEFPISKTPSGGLP
VKSSQALAARPAAELQSKVVPSKQILPSDNMEMEPETMETKSVTDYFSKLHMGSVVYSCT
SKRKGKLPDGEGKTAPEGGKKQQGPKKAEMEENAKGKFSTLASRDSPRLSTFNLERTAFR
KDSQRWYAAAEGGAAEKSGPEMGTGKAFQRVPGLGTMETECKDEGNPEGDNSGAPGLGQG
ESFLPDMTCVSSAKEVNHHEDADLSADDHPSKLPEAEQGVARLCDYHLAKRMSSLQSEGH
FSLQSSQCSSVDAGGSTGSSSTCATPMESPLCTSEGKHIISDASGKGMAYIPADERPAGL
PNPGATFKELHQQTDPMCHRMTVPVMHTAVNAEPLFGTLRDGCHRIPKIKETTV
Download sequence
Identical sequences F6WFI7
ENSMODP00000021643 ENSMODP00000021643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]