SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021650 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021650
Domain Number 1 Region: 343-463
Classification Level Classification E-value
Superfamily SET domain 2.22e-27
Family Histone lysine methyltransferases 0.035
Further Details:      
 
Domain Number 2 Region: 109-172
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.44e-16
Family PHD domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021650   Gene: ENSMODG00000017347   Transcript: ENSMODT00000022027
Sequence length 1646
Comment pep:known_by_projection chromosome:BROADO5:8:156366513:156428374:1 gene:ENSMODG00000017347 transcript:ENSMODT00000022027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDIYLCERCQPRSLDKERAVQLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTTITLTAARVTKVNDKKRKKSGEKEQNISK
CKKSFREGSRKSSRVKGSAPEIDPSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREAQ
RIALRLGSGNDKKEMNNKSESNPSNLIFKPPVESYIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHI
IEDGTIHLYIYSIQSIPKGTEITIGFDFDYGNCKYKVDCACLKENPECPVLKRCSEPTEN
INSGYETRRKKGKKEKDISKEKETQNQNITLDCESATNKMRSPDNKQRKLSPLRLSISNN
QEPDFIDDIEEKTAISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEIKTECKDTQMVNDAEVVQDTTKEETASKPTPAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDVEVTSQPNEPENTALVAEPETETAIAEIVTETEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKSSESLSEKPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKRRRKEPTENSSGSCKKRWLKQALEEENSAVLDKFSSLCQ
ERSRSPAVNGENKSPLLLNDSCSLPDLTTPLKKRRLYQLLDSAYSETSTPTPSPYATPTH
VDVSATDPSLFATPPRTKSEDETCRNGYKPIYSPVTPVTPCIQGNAMHFENISSPESSPE
IKRRVYTQEGYERTPTMLTVGPFRNSNLSEMGLQEIKTIGYSSPRNRTDVTRQCTGDKES
VSDFQIGLDVVEHTGIPKTMETPSQDRTDSNSQLEPAPCGGGRVYSSWVKSPERTGVNFS
SVNSNLRDLTPSHQLEVGGGFRVSESKCLLQDDSRGVFMETSVFCSSEDGLPPGFGRAVN
DSAIEGSCTPQNPPQKKKVSLLEYRKRQREARKSGSKADNFSLVTVSPHTTMGGNMSNSS
NPSDGCSNSGENGEQVDHTTSLPLPLPTAVYNATSEEISNTCPVKETSAGEKNEPEVQWT
ASTSVEQVRERSYQRALLLSDHRKDKDSGGESPCIPCSPNHVQSSPSSHSNHIPQLQLKV
PVPSFSELIEDPDPENPEPTTTNECLSPDTSLKTCKSPSKVSKPCSPGPTASAQSLGKTP
TKPDSQWETAVNTPETETTNPQKAELQQKQLSNSVQALSKTHSSQSHVRSSSEQLSQKLP
SAPLKLHCPPSPHVENPPKSSTPHPPVQHGYLSPKPPTQQLGSPYRAHHAQSPQVGTPQR
DSHRNFYPAAQSLQSNPPQPPAGALFTQTPSGQSVATYSQFNQQNLNSTAPPPPPPPPPS
ATSSYYQSQQSSANFQSYNQLKGGLPQQTVFTSGPNQALPGATSQQPVPGHHVTPGHFLP
SQNSTLHHQASAAPPPPPPPPAPFFI
Download sequence
Identical sequences F6WEY3
ENSMODP00000021650 ENSMODP00000021650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]