SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021677 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021677
Domain Number 1 Region: 35-242
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-47
Family DBL homology domain (DH-domain) 0.00053
Further Details:      
 
Domain Number 2 Region: 264-398
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000308
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021677   Gene: ENSMODG00000017355   Transcript: ENSMODT00000022055
Sequence length 402
Comment pep:novel chromosome:BROADO5:2:414901422:414921077:1 gene:ENSMODG00000017355 transcript:ENSMODT00000022055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKADHSQDRTTSITEDDLKLEVLVKLERKLQMDLAEKRTKIAGELLKSERKYIQMLEIVR
DVYVTPMKAALASNRAILSSTDIQIIFSDILCVLDLNKHFLDELTKRLQEWGPAQCLGEI
FTKFGLQLKTYTNFFNNYPVVLKTIEKCREMIPAFRAFLKRQDKTIVTRMMSLQELLLYP
SRRFEEYLNLLYGLRLHTPSEHGDREDLTTAIKQIKRYIGYINQLKQNVNRKDQLSDVER
SICGCPTLSEGNRFLIRVQDVAQLFCCNEEDCFSLRLYEHIHDLSLFLFSDALLVSHRTV
THTPFERTTRTTYQFLAIAALHRLLIEDIPDSKCMSSLFQSGRFRMLQNSRVHRGLQNIK
NAFILQGQKRQWICSTENEDKCVWLSVLQSAIRSSIEKYDWT
Download sequence
Identical sequences F6VYV3
ENSMODP00000021677 ENSMODP00000021677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]