SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021739 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000021739
Domain Number - Region: 611-641
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00428
Family A20-like zinc finger 0.038
Further Details:      
 
Domain Number - Region: 478-561
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0364
Family Cytochrome c3-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021739   Gene: ENSMODG00000017417   Transcript: ENSMODT00000022117
Sequence length 796
Comment pep:known_by_projection chromosome:BROADO5:2:413811776:413832155:1 gene:ENSMODG00000017417 transcript:ENSMODT00000022117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQQILPQALYLSNMRKAVKIRERTPEDIVKPTNGIIYHFKTMHRCTVEMFRTCQFCPQ
FREFILLALIDRSIQTSLESQRKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTD
LVLRKALYSTLKETDIRNFKFRWQLESLKSQEFVETGLRYDTRNWNEEWDNLIKMASPDT
SVVRGGLQYNSLEEIHILVLSNILRRPIIVISDKMVRSLESGSNFAPLKVGGIYLPLHWP
AQECYKYPIVLGYDSQHFAPLVTLKDSGPEIRAVPLVNRERGRFEDLKVHFLTDPETEMK
EKLLKEYLTVVEIPVQGWDHGTTHLINAAKLDEANLPKEINLVEDYFELVQHEYKKWQEN
TELNLGEAHVRNGLEPHLPQLSLMEVKCETPNCPFFMSVNTQPFCHECFERRQNAQNKPK
KQNSKPGVEKLTGVGLGTSQGEAHEPAGWKPEESPVMGPHSAPPTAPSFFLFSETTAMKC
KSPGCPFTLNVQHNGFCERCHHIRQLNPGCDLNNHRHLDAGKCQACLQDVTRTFNGICST
CFKRTTEASSASSSSFPASCHQRSFSDPSQLSQSIHQHPYRRNGHEASSGTISQAARNPE
NRTGTSKCRKAGCKFFGTPENRGFCTLCFIEYWENNRDPPASGQTDPAASRFQNTIPCLG
RECGTLGSTLFEGYCQKCFIEAQNQRFHEAKRTEEQLVRQSERSSQRRDVQRATQSSQRK
KCAKATCKNFVAHRGDELCPECQRLGQRLGPGVQRGEPVTEELPKQRCRAPACDHFGNAK
CNGYCNECYQFKQLYG
Download sequence
Identical sequences F7AJC4
ENSMODP00000021739 XP_007484683.1.35504 ENSMODP00000021739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]