SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021792 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021792
Domain Number 1 Region: 165-240
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000412
Family Zf-UBP 0.0052
Further Details:      
 
Domain Number 2 Region: 26-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000029
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021792   Gene: ENSMODG00000017462   Transcript: ENSMODT00000022171
Sequence length 462
Comment pep:novel chromosome:BROADO5:X:61910068:61912516:1 gene:ENSMODG00000017462 transcript:ENSMODT00000022171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEIYGRLHMYKTSKMATVKERVMIYNYMLGILNIPASVTRPNLHNFLAPFQEAINEVKII
KDATPSRYMALIKFNAKDVADTFYSVYNGCSFNQKNNEVCQLVYVGRIEVIKAGDGVRFP
MKSLIELPRCTICLERTGDSMKGILTWFCDQSFEGGSHQSQDDIMCPVCSYCHIPWREEP
RCLECGIRECLHICLICGLVGCGQNLRGHANKHFDETQHAYGMQLNNYKVWDYVENNYVQ
AGLCQCSNNAGQYGRKANERIDTTQLEYSYLLSNQLESQKIFWEKKIEHLEKETHEEIST
MKLKLNSTIEKYNKMEYKVNALLKEKQAMDKKCAHLRTKVARLCSELQQEQETNKRLRAN
QILLQKQLKEEKAQKESCYKKEMQINEIQEQLRGVMFYLETQQKINTLPTSPPLPLLPGE
TKQEIQEGQMNLAMADPGSIPTGTGKFEGGVQRRRGEGKRGQ
Download sequence
Identical sequences F6Z593
ENSMODP00000021792 ENSMODP00000021792 13616.ENSMODP00000021792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]