SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021795 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021795
Domain Number 1 Region: 231-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-81
Family Protein kinases, catalytic subunit 0.000000000248
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-39
Family SH2 domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 48-172
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-24
Family SH3-domain 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021795   Gene: ENSMODG00000017464   Transcript: ENSMODT00000022174
Sequence length 509
Comment pep:known_by_projection chromosome:BROADO5:4:425628394:425663093:1 gene:ENSMODG00000017464 transcript:ENSMODT00000022174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCCCSSSLDEDWMENIDVCERCHYPIVPLDAKDMLPMRNGSEVRDPLVDYNGLDPPVSP
LQDNLVIALHSYKPSHDGDLGFEKGEQLKILEQNGEWWKAQSLTTGQEGFIPFNFVAKVN
SLEPEPWFFKDLSRKDAERQLLAPGNTHGSFLIRESETTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVQHYSKVSDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKAGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTSTGVKLTIHKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTYGRIPYPGMTNPEVIQNLEQGYRMVRPDNCPEELYKLMMLCWKER
PEERPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences F6Z574
XP_007492945.1.35504 ENSMODP00000021795 ENSMODP00000021795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]