SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021904 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021904
Domain Number 1 Region: 32-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000738
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000628
Family Fibronectin type I module 0.021
Further Details:      
 
Domain Number 3 Region: 200-244
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000011
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021904   Gene: ENSMODG00000017558   Transcript: ENSMODT00000022288
Sequence length 351
Comment pep:known_by_projection chromosome:BROADO5:2:405866050:405869989:-1 gene:ENSMODG00000017558 transcript:ENSMODT00000022288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGKMGPMSFAFVFLLTFCNREIAGQDCSGQCQCGVGPPPECPAGVSLVPDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCVFGGMVYRSGESFQSSC
KYQCTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCEEPKDKDQTAVGPA
LAAFRLEDTYGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNAFCRLEKQSRLCM
VRPCEVALEENIKKGKKCIRTPRISKPVKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRT
ATLPVEFKCPDGEVMKKKMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences F7BSS5
ENSMODP00000021904 13616.ENSMODP00000021904 ENSMODP00000021904 XP_001380410.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]