SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021934 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021934
Domain Number 1 Region: 259-457
Classification Level Classification E-value
Superfamily LigT-like 1.92e-17
Family 2'-5' RNA ligase LigT 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021934   Gene: ENSMODG00000017586   Transcript: ENSMODT00000022320
Sequence length 522
Comment pep:known_by_projection chromosome:BROADO5:2:404835605:405003983:1 gene:ENSMODG00000017586 transcript:ENSMODT00000022320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLPPPPPPLLPPQPWPGGPRSCCCGCRCCCCYRCRASLGAAPDASPAQPLRQLPQQ
RGRRRRAPRRRRRRGEAGAGAAAAAAGSGTDRWPLPLPSPLLPVPLYLLPIPASHCALAP
LSPGLVLSQAPGPEAQRGKPSGLLRGWAVQTSAFSSSSFYCSATWEESFSPVEEMDPRGN
GINSKNLRMMSRRKRKSIQGWDPDNMMAEMPFSTIARKDEFLLPIGPEINSKKRQEKMGP
GKEDLMKKRNKKKKDYQPNYFLSIPITNKEITRGIQTLQNTIIQQDKRLSRVMSNCGSFH
VTLLVMHLLNEEEVNIGIDALLEIKTLIEEILQGRNLNLPFQGVGNFGNQVGFVKLAEGD
HVPVLLEIAEAAKRTFQEKGIMAGENRSFKPHLTFMKLSKSPELRRKGVKKIDPELYEKF
ADHKFGEESLYRVDLCSMLKEKQSNGYYHCESSIVIGEKNGREPDDAELVRLSKKLVENA
VLKAVQQYLEETQNKTRQVDGSPVKAEEPMQSDRNDSDNNRK
Download sequence
Identical sequences F7B585
ENSMODP00000021934 ENSMODP00000021934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]