SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021972 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021972
Domain Number 1 Region: 11-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.65e-20
Family Canonical RBD 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021972   Gene: ENSMODG00000017619   Transcript: ENSMODT00000022359
Sequence length 197
Comment pep:novel chromosome:BROADO5:1:206042066:206042736:1 gene:ENSMODG00000017619 transcript:ENSMODT00000022359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSNTMASNITSKTDPCSMNSRVFIGNLNTLDIKKTDVEAIFSKYGKIVDCSVHKGIAFV
PYVNERNACAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKCSAAEMYASVPEYPSPT
CTPIAWAVVPSKCQSVSGNTSHRGKSSFNSKSGQRGSSSKSGKLKGDYLQTIKKELTQIK
QKVDSLLESLEKIEEEQ
Download sequence
Identical sequences F6ZTA4
13616.ENSMODP00000021972 ENSMODP00000021972 ENSMODP00000021972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]