SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022002 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022002
Domain Number 1 Region: 187-305
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-27
Family SH2 domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022002   Gene: ENSMODG00000017645   Transcript: ENSMODT00000022389
Sequence length 311
Comment pep:known_by_projection chromosome:BROADO5:1:203170397:203180422:-1 gene:ENSMODG00000017645 transcript:ENSMODT00000022389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAILEDYADPFDAQETGEGPAVPVGPTEKMPENDGYMEPYEAQKMMAGEHLGKGEQHKSG
NRFERLNFPRLEVPFFSSYCLTLAEIRGSKEAAAKPLPLYDTPYEPAEEGLSPEGEGTGR
PRESRLPEDDERPPEEYDQPWEWKKERISKAFAAQFEGSENCLSPSREEKGRPLPRLPGV
NSKTVKPLSIEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSET
SKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHM
SLLYPVAIRTL
Download sequence
Identical sequences F6Z948
ENSMODP00000022002 13616.ENSMODP00000022002 ENSMODP00000022002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]