SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022014 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022014
Domain Number 1 Region: 190-375
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.15e-51
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 10-179
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.15e-49
Family Canonical RBD 0.0000252
Further Details:      
 
Domain Number 3 Region: 521-647
Classification Level Classification E-value
Superfamily PABC (PABP) domain 6.8e-47
Family PABC (PABP) domain 0.00000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022014   Gene: ENSMODG00000017657   Transcript: ENSMODT00000022401
Sequence length 656
Comment pep:novel chromosome:BROADO5:4:423548404:423564234:-1 gene:ENSMODG00000017657 transcript:ENSMODT00000022401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGAKAKEFTNVYIKNFGDDMDDGRLKELFSKYGKTLSVKVMTDPSGKSKGFGFVSFEK
HEDANKAVEEMNGKDINGKMVFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
LDDTIDDEKLRKEFSPFGSITSAKVVMLEDGRSKGFGFVCFSSPDEATKAVTEMNGRIVG
SKPLYVALAQRKEERKAHLTNQYMQRIAGMRALPANTIINQFQPTPGGYFMPAVPQAQNR
PPYYAPNQIAQMRPNPRWQQGGRPQGFQGVPNTIRQSGPRPALRHLTPASNTQASRGLPT
TPQRVVSFCLALPPVGAGGGEDIGLWSCHLRVPTAVQNLSPRPSVATPAPRAVPPYKYAA
NVRSPHPAIQPLQTPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHNNLA
GKITGMLLEIDNSELLHMLESPESLRSKVEEAVAVLQAHHAKKEAAQKVAVVAATS
Download sequence
Identical sequences F6YJX5
ENSMODP00000022014 ENSMODP00000022014 13616.ENSMODP00000022014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]