SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022015 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022015
Domain Number 1 Region: 135-300
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.04e-73
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000359
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.57e-28
Family Canonical RBD 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022015   Gene: ENSMODG00000017659   Transcript: ENSMODT00000022402
Sequence length 301
Comment pep:novel chromosome:BROADO5:4:423521429:423541987:-1 gene:ENSMODG00000017659 transcript:ENSMODT00000022402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATKRVLYVGGLAEEVDEKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMKIKEGSSRPVWSDDEWLKKFSGKTLEENKEEGASE
PPKSEAQEGEPPAKKARANPQVYMDIKIGNKPAGRIQMLLRSDIVPMTVENFRCLCTHEK
GFGFKGSSFHRIIPQFMCQAGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFITCDKTDWLDGKHVVFGEVTEGMDVVQKIEAQGSKDGKPKQKVIISDCGEY
V
Download sequence
Identical sequences F6YJW7
ENSMODP00000022015 13616.ENSMODP00000022015 ENSMODP00000022015 XP_001365208.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]