SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022041 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022041
Domain Number 1 Region: 41-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 2 Region: 146-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000628
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022041   Gene: ENSMODG00000017677   Transcript: ENSMODT00000022428
Sequence length 279
Comment pep:known_by_projection chromosome:BROADO5:2:399323189:399437879:1 gene:ENSMODG00000017677 transcript:ENSMODT00000022428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRLISWFFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFVLERNGMKQIGVCLSSCPSGYYGTRSPDINKCTKCKADCDTCFNKNFCTKCKNGFYL
HLGKCLDTCPEGLEANNHTMECASIVHCEASEWSPWSPCTKKGKTCGFKRGTETRFREII
QLPSAKGNLCPPTSETRKCMVQRKKCPKGERGKKGRERKRKKLNKEENKETRPENKGQDP
SSESRDQRENKDKQQQKKRKVQDKQQKSSMDLFGGLTSP
Download sequence
Identical sequences F7GFR6
ENSMODP00000022041 ENSMODP00000022041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]