SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022067 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022067
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-34
Family Ubiquitin-related 0.0000218
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 1.83e-19
Family Ribosomal protein S27a 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022067   Gene: ENSMODG00000017695   Transcript: ENSMODT00000022454
Sequence length 156
Comment pep:novel chromosome:BROADO5:1:532227461:532227969:1 gene:ENSMODG00000017695 transcript:ENSMODT00000022454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFIKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSAYN
IQKESTLHLVLRLRGSAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISCLRRE
CPSDECGAGIFMASYFDRHYCGKCCLTYYFNKPEDK
Download sequence
Identical sequences F7FV67
13616.ENSMODP00000022067 ENSMODP00000022067 ENSMODP00000022067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]