SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022089 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022089
Domain Number 1 Region: 395-453
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000671
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Domain Number 2 Region: 327-393
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000247
Family IBR domain 0.072
Further Details:      
 
Domain Number 3 Region: 252-325
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000965
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022089   Gene: ENSMODG00000017716   Transcript: ENSMODT00000022476
Sequence length 533
Comment pep:known_by_projection chromosome:BROADO5:2:396374655:396535203:1 gene:ENSMODG00000017716 transcript:ENSMODT00000022476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEEQSTVNADGPAEGRSLGSGEGVGKEQPGPRQPQGDSSGAAGPRAPSPDPGGGGGGSR
GRASPEHGKRGSKARGQPTAAGSTGPLDPRTLQQQQQKQEEEQSRGEWDRSSEPELGERA
STPDGLVLEVLGRRRHPPAKRHIYCTVYCVENDLPEAPTQEEPSPPNILACRVPLAVSSS
TTSSTTSATSSPSPGLTPTSDPLAFDGGGGGSSVELDLYLTPEPFSVASLIGAPPYPGLG
GLGDPYSPLLVLSCRVCLEDKAIKPLTCCKKAVCEECLKRYLSSQVQLGQAEIKCPITEC
SEYLEETTVLYNLPHDDVIKYKYFLELSRIDSSTKPCPQCKHFTTYKKKGHGPNPTKSEN
KYKIQCPICQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNAQKCPKCKIH
IQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLV
RGSVCAGKLIIAPLILVLGLALGAIAVVIGLFVFPIYCLCKKQRKRSRTGMPW
Download sequence
Identical sequences F7FHS3
XP_007484568.1.35504 ENSMODP00000022089 ENSMODP00000022089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]